DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and CYP94D1

DIOPT Version :10

Sequence 1:NP_610743.2 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_174713.1 Gene:CYP94D1 / 840356 AraportID:AT1G34540 Length:498 Species:Arabidopsis thaliana


Alignment Length:87 Identity:20/87 - (22%)
Similarity:39/87 - (44%) Gaps:8/87 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LLETQKSEDVESSI--PVSTIEPNLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNE 153
            |.::.||:.|.:||  |.::...:|..:.....::..|.|..|      |.:|.|....|.:...
plant    19 LTKSHKSDSVTTSISFPSNSKTRSLRTISVRAGLIEPDGGKLV------DLVVPEPRRREKKHEA 77

  Fly   154 QEEAQIDVYHVDGQLQHIVMEG 175
            .:..::.:..:|.|..|::.||
plant    78 ADLPRVRLTAIDLQWMHVLSEG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_610743.2 CYP6-like 69..507 CDD:410679 20/87 (23%)
CYP94D1NP_174713.1 CYP86A 64..490 CDD:410687 8/36 (22%)

Return to query results.
Submit another query.