DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286335.1 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:197 Identity:35/197 - (17%)
Similarity:71/197 - (36%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYNNLFFV------RDAHWKGIRTKLTPV 140
            |.:|:.|.|.::.|:.|     |..:.:     ..:|.:|..|:      ....|...|:.|.|.
plant   106 PNVIVMDPETLREIMSK-----HELFPK-----PKIGSHNHVFLSGLLNHEGPKWSKHRSILNPA 160

  Fly   141 FTSGKVKQMYTLMQEIGKDLELALQRRGEKNSGSFITEIKEICAQFSTDSIATIAFGIRANSLEN 205
            |....:|.:........|:: |....|.....|:...:....|...:.:.:|..:||   :|.::
plant   161 FRIDNLKSILPAFNSSCKEM-LEEWERLASAKGTMELDSWTHCHDLTRNMLARASFG---DSYKD 221

  Fly   206 PNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSLMRIQFFTADFSHFMRSTIGHVMEERERSGL 270
                    |.|:|..   :.:...:.....:.|.:...:|....|:..:|.|      ||:...:
plant   222 --------GIKIFEI---QQEQIDLGLLAIRAVYIPGSKFLPTKFNRRLRET------ERDMRAM 269

  Fly   271 LR 272
            .:
plant   270 FK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_001286335.1 p450 56..508 CDD:278495 35/197 (18%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.