DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and CYP96A4

DIOPT Version :9

Sequence 1:NP_001286335.1 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:483 Identity:105/483 - (21%)
Similarity:191/483 - (39%) Gaps:99/483 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GMHLSEIYNDPRLKDEAVVGIYSMNKPGLII------RDIEL------IKSILIKDFNRFHNRYA 108
            ||....::..||:.|.....:.:.|..|..|      .||.|      |:.||..:|..:     
plant    41 GMLPGVLFQIPRIYDFVTEALEAENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNFVNY----- 100

  Fly   109 RCDPHG-------DPLGYNNLFFVRDAHWKGIRTKLTPVFTSGKVK--QMYTLMQEIGKDLELAL 164
               |.|       :.|| :.:|.|....|:.:|.....:|:....:  .:.|.:.::.:.|...|
plant   101 ---PKGKKFNKIFEFLG-DGIFNVDSGLWEDMRNSSHAIFSHQDFQSFSVSTSVSKLSQGLVPIL 161

  Fly   165 QRRGEKNSGSFITEIKEICAQFSTDSIATIAFGI--RANSLENPNAEFRNYGRKMFTFTVARAKD 227
            ....||:   .:.:::::..:|..|:.:|:..|.  ::.|:|.|..||            |.|.|
plant   162 DNAVEKH---ILVDLQDLFQRFLFDTSSTLMAGYDPKSLSVEMPKVEF------------ADAMD 211

  Fly   228 FFVAFFLPKLVSLMRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAEPSK 292
                    .:...|..:.....|...::|.||..:|::.|.||   |:.|.::.....|..|..|
plant   212 --------GVADAMFYRHLKPAFLWSIQSWIGVGIEKKMRRGL---DVFDQMLGKIISAKREEIK 265

  Fly   293 PH---------------------------YAKNQDFLVAQAGVFFTAGFETSSSTMSFALYEMAK 330
            .|                           ...|..|:.........|..:|:||.:::..:.::|
plant   266 NHGIHDSKGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDTTSSALTWFFWLLSK 330

  Fly   331 HPEMQKRLRDEINEALVEGGGSLSYEKIQSLEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLS 395
            :||...::|.|||:.:.:    .....:..|.||...|.|.||:||.:||..:.    ..:||:.
plant   331 NPEAMTKIRQEINKKMPK----FDPADLDKLVYLDGAVCETLRLYPSVPFNHKS----PAKPDVL 387

  Fly   396 LKPFYDYTLENGTPVFIPIYALHHDPKYWTNPSQ-FDPERF--SPANRKNIVAMAYQPFGSGPHN 457
            ..   .:.::....|.||||:|......|.:.:: |.|||:  .....:...:..:..|.:||..
plant   388 PS---GHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAGPRT 449

  Fly   458 CIGSRIGLLQSKLGLVSLLKNHSVRNCE 485
            |:|.|:..||.|...|.:::|:.::..|
plant   450 CLGKRLTFLQMKTVAVEIIRNYDIKVVE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_001286335.1 p450 56..508 CDD:278495 105/483 (22%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 105/483 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.