DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and Cyp12a5

DIOPT Version :9

Sequence 1:NP_001286335.1 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_650782.1 Gene:Cyp12a5 / 42293 FlyBaseID:FBgn0038680 Length:536 Species:Drosophila melanogaster


Alignment Length:473 Identity:115/473 - (24%)
Similarity:201/473 - (42%) Gaps:122/473 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PGLIIRDIELIKSILIKDFN-RFHNRYA-RCDPHGDPLGYNNLFFVRD-------------AHWK 131
            ||::.|| .|:.:...|||. .|.|... ...|..|.|.|:...:.:|             ..|.
  Fly    92 PGMMGRD-GLVMTHNPKDFEVVFRNEGVWPFRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWG 155

  Fly   132 GIRTKLTPVFTSGK-VKQMYTLMQEIGKD-LELALQRRG---EKNSGSFITEIKEICAQFSTDSI 191
            ..|:.:.||....| |:..:..|.::.:: :||..:.|.   ::..|:|:..|.    :::.:|:
  Fly   156 DFRSIVNPVLMQPKNVRLYFKKMSQVNQEFVELIKEIRDASTQEVPGNFLETIN----RWTLESV 216

  Fly   192 ATIA----FGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFV-------------AFFLPKLVS 239
            :.:|    .|:...|.:|..|      .|:|.:    ..:||:             .|..|.|..
  Fly   217 SVVALDKQLGLLRESGKNSEA------TKLFKY----LDEFFLHSADLEMKPSLWRYFKTPLLKK 271

  Fly   240 LMRIQFFTADFSHFMRSTIGHV------MEERERSGLLR----NDLIDVLVSLRKEAAAEPSKPH 294
            ::|    |.|  .....|:.:|      :|:..:.|::|    ..:::.|:.:.|:.|.      
  Fly   272 MLR----TMD--SVQEVTLKYVDEAIERLEKEAKEGVVRPEHEQSVLEKLLKVDKKVAT------ 324

  Fly   295 YAKNQDFLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEKIQ 359
             ....|.|:        ||.:|:|||.:..|..:||:||.|.|||:|:.:.|.......:...::
  Fly   325 -VMAMDMLM--------AGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKDSEFTEASMK 380

  Fly   360 SLEYLAMVVDEVLRMYPVL----PFLDREYESVEGQPDLSLKPFYDYTLENGTPV-FIPIYALHH 419
            ::.||...:.|..|:||::    ..|.|: ..:.|           |.:..||.| .|||.:|:.
  Fly   381 NVPYLRACIKESQRVYPLVIGNARGLTRD-SVISG-----------YRVPAGTIVSMIPINSLYS 433

  Fly   420 DPKYWTNPSQFDPERF----------SPAN---RKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLG 471
            : :|:..|::|.|||:          .|||   .||  ...:.|||.||..|:|.||..::.:||
  Fly   434 E-EYFPKPTEFLPERWLRNASDSAGKCPANDLKTKN--PFVFLPFGFGPRMCVGKRIVEMELELG 495

  Fly   472 LVSLLK------NHSVRN 483
            ...|::      |||.:|
  Fly   496 TARLIRNFNVEFNHSTKN 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_001286335.1 p450 56..508 CDD:278495 115/473 (24%)
Cyp12a5NP_650782.1 p450 81..531 CDD:278495 115/473 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.