DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and Cyp4ad1

DIOPT Version :10

Sequence 1:NP_610743.2 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:31 Identity:11/31 - (35%)
Similarity:16/31 - (51%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 GVAVASSNNQSQPARTGGSAVTITSEGQRFQ 350
            |:|.|:::......:|...|||..|...|||
  Fly   115 GLASATASCPFYVVKTQLQAVTSGSYTARFQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_610743.2 CYP6-like 69..507 CDD:410679 11/31 (35%)
Cyp4ad1NP_610380.1 CYP4 73..511 CDD:410721 11/31 (35%)

Return to query results.
Submit another query.