DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6g1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001286335.1 Gene:Cyp6g1 / 36316 FlyBaseID:FBgn0025454 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:222 Identity:58/222 - (26%)
Similarity:100/222 - (45%) Gaps:8/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTP--IIGNTKVVFKMENSFGMHLS-EI 62
            ::||.:|..:|:.::  |....|...:..|..|....|.|  ::||.|.:.:.:...|...| :.
 Worm     4 LILTSILVSLVSFII--YVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDW 66

  Fly    63 YNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYNNLFFVRD 127
            ||....:.....|||...:..:.|.:.|.||.:.||:|:.|.:|........:.|..:.|....:
 Worm    67 YNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYE 131

  Fly   128 AHWKGIRTKLTPVFTSGKVKQMYTLMQEIGKDLELALQRRGEKNSGSFITEIKEICAQFSTDSIA 192
            :.||..|:.:.|:|::||:|.|:   :.|...::|.|:...||.|.....:|.:.....:.|.|.
 Worm   132 SGWKHTRSAIAPIFSTGKMKAMH---ETIHSKVDLFLEILKEKASSGQKWDIYDDFQGLTLDVIG 193

  Fly   193 TIAFGIRANSLENPNAEFRNYGRKMFT 219
            ..||.|.:|...:.|..|....||..|
 Worm   194 KCAFAIDSNCQRDRNDIFYVNARKFIT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6g1NP_001286335.1 p450 56..508 CDD:278495 45/165 (27%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 47/180 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.