DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and RUXF

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001190872.1 Gene:RUXF / 829145 AraportID:AT4G30220 Length:96 Species:Arabidopsis thaliana


Alignment Length:78 Identity:57/78 - (73%)
Similarity:69/78 - (88%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCN 69
            :|:|||||||.||||.|:||||||.||||||.|||.|||:||.||||.|:|.:||||||:|||||
plant    12 IPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNTEEYIDGQLTGNLGEILIRCN 76

  Fly    70 NVLYIKGMEDDDE 82
            ||||::|:.:|:|
plant    77 NVLYVRGVPEDEE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 53/67 (79%)
RUXFNP_001190872.1 Sm_F 15..83 CDD:212469 53/67 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I2127
eggNOG 1 0.900 - - E1_KOG3482
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134955
Inparanoid 1 1.050 133 1.000 Inparanoid score I1858
OMA 1 1.010 - - QHG53618
OrthoDB 1 1.010 - - D1600677at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto3913
orthoMCL 1 0.900 - - OOG6_102196
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2385
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.