DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and SNRPF

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_003086.1 Gene:SNRPF / 6636 HGNCID:11162 Length:86 Species:Homo sapiens


Alignment Length:84 Identity:66/84 - (78%)
Similarity:82/84 - (97%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCN 69
            :|:||||||||||||||:||||||.||||:|||||||||||||||||.|:|:::|:|||||||||
Human     3 LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCN 67

  Fly    70 NVLYIKGMEDDDEEGEMRD 88
            |||||:|:|:::|:||||:
Human    68 NVLYIRGVEEEEEDGEMRE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 58/67 (87%)
SNRPFNP_003086.1 Sm_F 6..74 CDD:212469 58/67 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5900
eggNOG 1 0.900 - - E1_KOG3482
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4380
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53618
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto91345
orthoMCL 1 0.900 - - OOG6_102196
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1274
SonicParanoid 1 1.000 - - X2385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.