DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and AT2G14285

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001077889.1 Gene:AT2G14285 / 5007874 AraportID:AT2G14285 Length:61 Species:Arabidopsis thaliana


Alignment Length:53 Identity:38/53 - (71%)
Similarity:47/53 - (88%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLYIKGMEDDDE 82
            ||||||.|||.|||:||.||||.|:|.:||||||:|||||||||::|:.:|:|
plant     2 EYKGFLASVDSYMNLQLGNTEEYIDGQLTGNLGEILIRCNNVLYVRGVPEDEE 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 35/45 (78%)
AT2G14285NP_001077889.1 Sm_F <1..48 CDD:212469 35/45 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3482
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53618
OrthoDB 1 1.010 - - D1600677at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102196
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.