DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and snrpf

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001003881.1 Gene:snrpf / 445404 ZFINID:ZDB-GENE-040930-9 Length:86 Species:Danio rerio


Alignment Length:84 Identity:65/84 - (77%)
Similarity:81/84 - (96%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCN 69
            :|:||||||||||||||:||||||.||||:|||||||||||||||||.::|::.|:|||||||||
Zfish     3 LPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYVDGALAGHLGEVLIRCN 67

  Fly    70 NVLYIKGMEDDDEEGEMRD 88
            |||||:|:|:::|:||||:
Zfish    68 NVLYIRGVEEEEEDGEMRE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 57/67 (85%)
snrpfNP_001003881.1 Sm_F 6..74 CDD:212469 57/67 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592590
Domainoid 1 1.000 117 1.000 Domainoid score I5870
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4333
OMA 1 1.010 - - QHG53618
OrthoDB 1 1.010 - - D1600677at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - otm24499
orthoMCL 1 0.900 - - OOG6_102196
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.