DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and CG9344

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_611528.1 Gene:CG9344 / 37372 FlyBaseID:FBgn0034564 Length:79 Species:Drosophila melanogaster


Alignment Length:63 Identity:31/63 - (49%)
Similarity:41/63 - (65%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLYI 74
            |:|.:.|:||.|||..|.:|:|.|..:|||||:.|..|||.:.|.:....|:..||.||||||
  Fly    10 FINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 31/63 (49%)
CG9344NP_611528.1 LSm6 8..73 CDD:212473 31/63 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.