powered by:
Protein Alignment SmF and CG9344
DIOPT Version :9
Sequence 1: | NP_523708.2 |
Gene: | SmF / 36314 |
FlyBaseID: | FBgn0000426 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611528.1 |
Gene: | CG9344 / 37372 |
FlyBaseID: | FBgn0034564 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 31/63 - (49%) |
Similarity: | 41/63 - (65%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 FLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLYI 74
|:|.:.|:||.|||..|.:|:|.|..:|||||:.|..|||.:.|.:....|:..||.||||||
Fly 10 FINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYI 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmF | NP_523708.2 |
Sm_F |
8..76 |
CDD:212469 |
31/63 (49%) |
CG9344 | NP_611528.1 |
LSm6 |
8..73 |
CDD:212473 |
31/63 (49%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439077 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000850 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11021 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.940 |
|
Return to query results.
Submit another query.