DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and smf1

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_596101.1 Gene:smf1 / 2540330 PomBaseID:SPBC3E7.14 Length:78 Species:Schizosaccharomyces pombe


Alignment Length:70 Identity:50/70 - (71%)
Similarity:61/70 - (87%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCN 69
            :|:||||||.||.||||||:|||||||||.|.|||.|||:||.|.||:::|..||:|||:|||||
pombe     4 VPVNPKPFLQGLIGKPVLVRLKWGQEYKGTLQSVDSYMNLQLLNAEELVDGVKTGDLGEILIRCN 68

  Fly    70 NVLYI 74
            |||::
pombe    69 NVLWV 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 49/67 (73%)
smf1NP_596101.1 Sm_F 7..75 CDD:212469 49/67 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 100 1.000 Domainoid score I1821
eggNOG 1 0.900 - - E1_KOG3482
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1545
OMA 1 1.010 - - QHG53618
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto101949
orthoMCL 1 0.900 - - OOG6_102196
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1274
SonicParanoid 1 1.000 - - X2385
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.