DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and snr-5

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_498708.1 Gene:snr-5 / 176103 WormBaseID:WBGene00004918 Length:85 Species:Caenorhabditis elegans


Alignment Length:82 Identity:55/82 - (67%)
Similarity:68/82 - (82%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAGMPINPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVL 65
            |||..|:|||||||.||||.|:.|||||.||||.||:||.|||:|||:.||.|:|:..|||||:|
 Worm     1 MSAVQPVNPKPFLNSLTGKFVVCKLKWGMEYKGVLVAVDSYMNLQLAHAEEYIDGNSQGNLGEIL 65

  Fly    66 IRCNNVLYIKGMEDDDE 82
            ||||||||:.|::.::|
 Worm    66 IRCNNVLYVGGVDGENE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 49/67 (73%)
snr-5NP_498708.1 Sm_F 8..76 CDD:212469 49/67 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165182
Domainoid 1 1.000 98 1.000 Domainoid score I4508
eggNOG 1 0.900 - - E1_KOG3482
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134955
Inparanoid 1 1.050 121 1.000 Inparanoid score I3328
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53618
OrthoDB 1 1.010 - - D1600677at2759
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 1 1.000 - - oto17385
orthoMCL 1 0.900 - - OOG6_102196
Panther 1 1.100 - - LDO PTHR11021
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1274
SonicParanoid 1 1.000 - - X2385
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.