DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and SmE

DIOPT Version :10

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_311506.3 Gene:SmE / 1272597 VectorBaseID:AGAMI1_011661 Length:90 Species:Anopheles gambiae


Alignment Length:49 Identity:14/49 - (28%)
Similarity:28/49 - (57%) Gaps:1/49 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KGFLVSVDGYMNMQLANTEEV-IEGSVTGNLGEVLIRCNNVLYIKGMED 79
            :|.:|..|.|||:.|...||. |:......||.::::.:|:..|:.:::
Mosquito    42 EGHIVGFDEYMNLVLDEAEEFNIKKQTRRQLGRIMLKGDNITLIQNVQN 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 14/44 (32%)
SmEXP_311506.3 Sm_E 9..87 CDD:212465 14/44 (32%)

Return to query results.
Submit another query.