DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and LSM6

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_009011.1 Gene:LSM6 / 11157 HGNCID:17017 Length:80 Species:Homo sapiens


Alignment Length:66 Identity:32/66 - (48%)
Similarity:42/66 - (63%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLY 73
            |..||..:.|:||:|||..|.:|:|.|..:|||||:.|..|||.:.|.:....|:..||.|||||
Human     8 PSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLY 72

  Fly    74 I 74
            |
Human    73 I 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 32/66 (48%)
LSM6NP_009011.1 LSm6 7..74 CDD:212473 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.