DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmF and LOC108350623

DIOPT Version :9

Sequence 1:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_038962522.1 Gene:LOC108350623 / 108350623 RGDID:11410735 Length:90 Species:Rattus norvegicus


Alignment Length:82 Identity:57/82 - (69%)
Similarity:76/82 - (92%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 INPKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNV 71
            :||||||||||||||.|:||||.|||.:|||:||||:.|||||||.|:|:::|:|||||||.:||
  Rat     9 LNPKPFLNGLTGKPVTVRLKWGMEYKDYLVSIDGYMDTQLANTEEYIDGALSGHLGEVLIRYSNV 73

  Fly    72 LYIKGMEDDDEEGEMRD 88
            ||::|:|:::|:||||:
  Rat    74 LYVRGIEEEEEDGEMRE 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmFNP_523708.2 Sm_F 8..76 CDD:212469 50/67 (75%)
LOC108350623XP_038962522.1 Sm_F 10..78 CDD:212469 50/67 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1600677at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.