DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and AT5G50460

DIOPT Version :10

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_568728.1 Gene:AT5G50460 / 835114 AraportID:AT5G50460 Length:69 Species:Arabidopsis thaliana


Alignment Length:93 Identity:17/93 - (18%)
Similarity:29/93 - (31%) Gaps:19/93 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NDWVCDCRPGYVYSPPQDSCYPLFQQGFCQPGEYVDLARPSMIVKC--TRNVCTGRNEVPYREQC 141
            |..:..|..|.:|.............|. :|.|.:....|...:|.  |..:|  |...|:.::.
plant   219 NSHIASCLAGLLYPTNTLRTRSAVSVGI-EPWEIIRTLCPMTTLKFLHTAQIC--RRGTPFWDRV 280

  Fly   142 V--------------KLHQNNRLCKIER 155
            .              :||.:..|..:.|
plant   281 TLSLTKNIPRTSPDGRLHHSTSLLAVSR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 secE <12..68 CDD:469787
AT5G50460NP_568728.1 secE <7..68 CDD:469787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.