DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8860 and AT3G48570

DIOPT Version :9

Sequence 1:	NP_610738.1	Gene:	CG8860 / 36310	FlyBaseID:	FBgn0033691	Length:	68	Species:	Drosophila melanogaster
Sequence 2:	NP_566909.1	Gene:	AT3G48570 / 824017	AraportID:	AT3G48570	Length:	69	Species:	Arabidopsis thaliana

Alignment Length:	68	Identity:	44/68 - (64%)
Similarity:	55/68 - (80%)	Gaps:	0/68 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
            |:.:....:|.|.|||.|:|||:||.|||||||.|:|:.||:||.:|||:||||||:.|||||||
plant     1 MEAIDSAIDPLRDFAKSSVRLVQRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLVFIPINNII 65

  Fly    66 VGS 68
            |||
plant    66 VGS 68

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8860	NP_610738.1	SecE	<12..68	CDD:412402	40/55 (73%)
AT3G48570	NP_566909.1	SecE	<11..68	CDD:412402	40/56 (71%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	92	1.000	Domainoid score	I2580
eggNOG	1	0.900	-	-		E1_COG2443
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	103	1.000	Inparanoid score	I2148
OMA	1	1.010	-	-		QHG53965
OrthoDB	1	1.010	-	-		D1623399at2759
OrthoFinder	1	1.000	-	-		FOG0001695
OrthoInspector	1	1.000	-	-		mtm1011
orthoMCL	1	0.900	-	-		OOG6_101625
Panther	1	1.100	-	-	O	PTHR12309
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X1245
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
	13	12.840