DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and AT3G48570

DIOPT Version :10

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_566909.1 Gene:AT3G48570 / 824017 AraportID:AT3G48570 Length:69 Species:Arabidopsis thaliana


Alignment Length:68 Identity:44/68 - (64%)
Similarity:55/68 - (80%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
            |:.:....:|.|.|||.|:|||:||.|||||||.|:|:.||:||.:|||:||||||:.|||||||
plant     1 MEAIDSAIDPLRDFAKSSVRLVQRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLVFIPINNII 65

  Fly    66 VGS 68
            |||
plant    66 VGS 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 secE <12..68 CDD:469787 40/55 (73%)
AT3G48570NP_566909.1 secE <11..68 CDD:469787 40/56 (71%)

Return to query results.
Submit another query.