powered by:
Protein Alignment CG8860 and LOC499136
DIOPT Version :9
Sequence 1: | NP_610738.1 |
Gene: | CG8860 / 36310 |
FlyBaseID: | FBgn0033691 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041402.1 |
Gene: | LOC499136 / 499136 |
RGDID: | 1559542 |
Length: | 233 |
Species: | Rattus norvegicus |
Alignment Length: | 60 |
Identity: | 48/60 - (80%) |
Similarity: | 52/60 - (86%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIP 60
||:|::|.||.|.|.|||||||||.||||||||||||.|||:|||||||||||||||..|
Rat 173 MDQVMQFVEPSRQFVKDSIRLVKRRTKPDRKEFQKIARATAIGFAIMGFIGFFVKLIPHP 232
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8860 | NP_610738.1 |
SecE |
<12..68 |
CDD:412402 |
42/49 (86%) |
LOC499136 | NP_001041402.1 |
DUF1725 |
125..140 |
CDD:285525 |
|
SecE |
<184..229 |
CDD:294328 |
39/44 (89%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2443 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H40767 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623399at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001695 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12309 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.920 |
|
Return to query results.
Submit another query.