DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and LOC499136

DIOPT Version :9

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001041402.1 Gene:LOC499136 / 499136 RGDID:1559542 Length:233 Species:Rattus norvegicus


Alignment Length:60 Identity:48/60 - (80%)
Similarity:52/60 - (86%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIP 60
            ||:|::|.||.|.|.|||||||||.||||||||||||.|||:|||||||||||||||..|
  Rat   173 MDQVMQFVEPSRQFVKDSIRLVKRRTKPDRKEFQKIARATAIGFAIMGFIGFFVKLIPHP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 SecE <12..68 CDD:412402 42/49 (86%)
LOC499136NP_001041402.1 DUF1725 125..140 CDD:285525
SecE <184..229 CDD:294328 39/44 (89%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40767
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12309
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.