DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and Sec61gamma

DIOPT Version :10

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_608337.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster


Alignment Length:68 Identity:67/68 - (98%)
Similarity:67/68 - (98%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
            ||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||
  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65

  Fly    66 VGS 68
            |||
  Fly    66 VGS 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 secE <12..68 CDD:469787 54/55 (98%)
Sec61gammaNP_608337.1 secE <12..68 CDD:469787 54/55 (98%)

Return to query results.
Submit another query.