DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and sec-61.G

DIOPT Version :9

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001379136.1 Gene:sec-61.G / 179510 WormBaseID:WBGene00001303 Length:68 Species:Caenorhabditis elegans


Alignment Length:68 Identity:54/68 - (79%)
Similarity:60/68 - (88%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
            ||:.....||.|.|:|||.|||||||||||||:||||:|||:|||||||||||||||||||||||
 Worm     1 MDQFQALIEPARQFSKDSYRLVKRCTKPDRKEYQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65

  Fly    66 VGS 68
            ||:
 Worm    66 VGA 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 SecE <12..68 CDD:412402 49/55 (89%)
sec-61.GNP_001379136.1 SecE <11..68 CDD:412402 49/56 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162227
Domainoid 1 1.000 100 1.000 Domainoid score I4408
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40767
Inparanoid 1 1.050 113 1.000 Inparanoid score I3422
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm14547
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - O PTHR12309
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2276
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.