powered by:
Protein Alignment CG8860 and Gm30534
DIOPT Version :9
Sequence 1: | NP_610738.1 |
Gene: | CG8860 / 36310 |
FlyBaseID: | FBgn0033691 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006513019.1 |
Gene: | Gm30534 / 102632470 |
MGIID: | 5589693 |
Length: | 68 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 51/67 - (76%) |
Similarity: | 58/67 - (86%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
||:|::|.||...|.||||.||||||||||||||:||:|||:||.||||||||.|.|||||||:|
Mouse 1 MDQVMQFIEPSWQFVKDSIHLVKRCTKPDRKEFQEIAMATAIGFVIMGFIGFFAKRIHIPINNVI 65
Fly 66 VG 67
||
Mouse 66 VG 67
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8860 | NP_610738.1 |
SecE |
<12..68 |
CDD:412402 |
45/56 (80%) |
Gm30534 | XP_006513019.1 |
SecE |
<14..67 |
CDD:382036 |
43/52 (83%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623399at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.