powered by:
Protein Alignment CG8860 and sec61g
DIOPT Version :9
Sequence 1: | NP_610738.1 |
Gene: | CG8860 / 36310 |
FlyBaseID: | FBgn0033691 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915421.1 |
Gene: | sec61g / 100492802 |
XenbaseID: | XB-GENE-484989 |
Length: | 66 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 57/66 - (86%) |
Similarity: | 62/66 - (93%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
||:|::|.||.|.|.||||||||||||||||||||||:|||:|||||||||||||||||||||||
Frog 1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65
Fly 66 V 66
|
Frog 66 V 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8860 | NP_610738.1 |
SecE |
<12..68 |
CDD:412402 |
51/55 (93%) |
sec61g | XP_004915421.1 |
SecE |
<12..66 |
CDD:412402 |
49/53 (92%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
103 |
1.000 |
Domainoid score |
I6709 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
1 |
1.000 |
- |
- |
|
H40767 |
Inparanoid |
1 |
1.050 |
120 |
1.000 |
Inparanoid score |
I4621 |
OMA |
1 |
1.010 |
- |
- |
|
QHG53965 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623399at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001695 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48758 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12309 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2276 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1245 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
12 | 12.110 |
|
Return to query results.
Submit another query.