DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8860 and sec61g

DIOPT Version :9

Sequence 1:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_004915421.1 Gene:sec61g / 100492802 XenbaseID:XB-GENE-484989 Length:66 Species:Xenopus tropicalis


Alignment Length:66 Identity:57/66 - (86%)
Similarity:62/66 - (93%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
            ||:|::|.||.|.|.||||||||||||||||||||||:|||:|||||||||||||||||||||||
 Frog     1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65

  Fly    66 V 66
            |
 Frog    66 V 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8860NP_610738.1 SecE <12..68 CDD:412402 51/55 (93%)
sec61gXP_004915421.1 SecE <12..66 CDD:412402 49/53 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6709
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40767
Inparanoid 1 1.050 120 1.000 Inparanoid score I4621
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm48758
Panther 1 1.100 - - O PTHR12309
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2276
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.