DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and zgc:158445

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001073540.2 Gene:zgc:158445 / 798069 ZFINID:ZDB-GENE-061215-78 Length:261 Species:Danio rerio


Alignment Length:203 Identity:50/203 - (24%)
Similarity:81/203 - (39%) Gaps:49/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LTATPSRIGQIMKYGFPGLDHVRSHSD-------------YVLSYDRRNRVPHWVFEHLTAESVA 117
            |.|.|..|..|:|      |.|...::             :...||...::|  ||   :|.:..
Zfish    33 LEAQPPVIPDILK------DSVSQDNNRYKLICQGKDKAYFATLYDTTKKIP--VF---SAYNYI 86

  Fly   118 KNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSG---YDRGHMAAAGNHRLHQKHCDETFYLSNMA 179
            |.|...:.|..|..|..:.. .:::|.|||:|.   ..|||:... ::.:.|:....||.|:|:.
Zfish    87 KTDVKTKRKKTFVIDTELQD-AQAKNEDYRQSNKIEMSRGHLFPK-SYAVDQEAAYATFTLTNVV 149

  Fly   180 PQVGQGFNRDAWNTLEAHVRRL--TKTYSN-----VYVCTGPLYLPHKEDDGKSYVKYEVIGANT 237
            || .:.||...|:..|...:..  |...||     .:|.||.  :|.:          :.:..:.
Zfish   150 PQ-QKKFNNGEWSKKENEFKSSMDTDCLSNNGRPEAFVVTGA--IPSE----------KTLLNDK 201

  Fly   238 VAVPTHFY 245
            |.:|||.|
Zfish   202 VNIPTHMY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 50/203 (25%)
NUC 77..309 CDD:238043 45/192 (23%)
zgc:158445NP_001073540.2 Endonuclease_NS 64..227 CDD:214889 42/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.