Sequence 1: | NP_610737.1 | Gene: | EndoG / 36309 | FlyBaseID: | FBgn0033690 | Length: | 310 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073540.2 | Gene: | zgc:158445 / 798069 | ZFINID: | ZDB-GENE-061215-78 | Length: | 261 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 81/203 - (39%) | Gaps: | 49/203 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 LTATPSRIGQIMKYGFPGLDHVRSHSD-------------YVLSYDRRNRVPHWVFEHLTAESVA 117
Fly 118 KNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSG---YDRGHMAAAGNHRLHQKHCDETFYLSNMA 179
Fly 180 PQVGQGFNRDAWNTLEAHVRRL--TKTYSN-----VYVCTGPLYLPHKEDDGKSYVKYEVIGANT 237
Fly 238 VAVPTHFY 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EndoG | NP_610737.1 | NUC1 | 39..305 | CDD:224777 | 50/203 (25%) |
NUC | 77..309 | CDD:238043 | 45/192 (23%) | ||
zgc:158445 | NP_001073540.2 | Endonuclease_NS | 64..227 | CDD:214889 | 42/166 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |