DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and XB5812267

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001072816.1 Gene:XB5812267 / 780277 XenbaseID:XB-GENE-5812268 Length:297 Species:Xenopus tropicalis


Alignment Length:226 Identity:55/226 - (24%)
Similarity:86/226 - (38%) Gaps:52/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HVRSHSDYVL-----SYDRRNRV---PHWVFEHLTAESVAKNDAVDRSKCDFK---QDESIHPFF 139
            ||..:|.|:|     |..|||..   |..:...| :.|:......:.:..|.|   ..:::..|.
 Frog    76 HVPLYSAYILNRKHESLHRRNTFDVEPQLINIGL-SPSMQSESTTETAITDKKIPGNPKTLIAFS 139

  Fly   140 RSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKT 204
            ::.|.||....|.|||:....:|...... |.||.|:|..|.| .|||:..|...|..:...||.
 Frog   140 QAVNADYGNRSYHRGHLNPVCHHETKAAQ-DATFTLTNAVPMV-SGFNQGKWRVHEKRMIEETKD 202

  Fly   205 YSNVYVCTG----------PLYLPHK--------EDDGKSYVKYEVIGANTVAVPTHFYKVIVGE 251
            .:..||.||          .:.:|.:        .::||......|:..||..       .:|.:
 Frog   203 CNITYVVTGIIPGNNRLNNRVNIPSRVWSAYCCVNNNGKPVKSGAVLAENTKG-------AVVSK 260

  Fly   252 SADHKLHMESYVMPNQ---VISNDTPISVFQ 279
            ..|         :|.|   ::.|.| .|:|:
 Frog   261 IED---------LPRQLKNILGNIT-FSIFE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 55/226 (24%)
NUC 77..309 CDD:238043 55/226 (24%)
XB5812267NP_001072816.1 Endonuclease_NS 65..271 CDD:214889 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.