DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and si:dkey-85k7.11

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_684184.3 Gene:si:dkey-85k7.11 / 556323 ZFINID:ZDB-GENE-160728-145 Length:313 Species:Danio rerio


Alignment Length:283 Identity:65/283 - (22%)
Similarity:102/283 - (36%) Gaps:82/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RIGQIMKYGFPGLDHVRSHSDYVLSYD-------------------RRNRVPHWVFE-HLTAESV 116
            ||.|  :||    |.:|    |...||                   ||...| |::| .|.:...
Zfish    67 RICQ--RYG----DKLR----YATLYDSSCRLALYSAYTFKKSDGQRRMDTP-WMYEPQLVSPDE 120

  Fly   117 AKNDAVDRSKCDFKQ--DESIHPFFRSQNTDYRRS-GYDRGHMAAAGNHRLHQKHCDE---TFYL 175
            ..|..|..|..:..|  :||     ::...||..: .:.||.:    |...||....:   |:.|
Zfish   121 GGNMKVLPSSGEIDQLLEES-----QAVLADYVDAVEFARGPL----NPDQHQAGNQDKAATYTL 176

  Fly   176 SNMAPQVGQGFNRDAWNTLEAHVRRLTKTY--SNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTV 238
            :|:.||:.: |....|.|....|||....:  ...||.||..........||.         :.:
Zfish   177 TNVVPQITE-FLEGPWATYIDMVRRRLNNFCRGTAYVVTGVTVSGMTIRRGKE---------DRM 231

  Fly   239 AVPTHFYKVIVGESADHKLHME-SYVMP-------NQVISNDTPISVFQVPPESVE--------- 286
            |||.:.:........|.....| .::.|       |:::.:    ||.:||.:::|         
Zfish   232 AVPKYLWSAYCCPRFDRNSPYEVRFMFPTYAAYALNEIVGH----SVTEVPLKALETFLKTKSNT 292

  Fly   287 -RSAGLLFFDQINRKQLTTINGK 308
             :|..:.|.|.::..  |..|||
Zfish   293 DKSVSIFFKDCLSEN--THANGK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 62/278 (22%)
NUC 77..309 CDD:238043 62/278 (22%)
si:dkey-85k7.11XP_684184.3 Endonuclease_NS 77..289 CDD:214889 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.