DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and Tengl4

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_650038.2 Gene:Tengl4 / 41321 FlyBaseID:FBgn0037857 Length:378 Species:Drosophila melanogaster


Alignment Length:291 Identity:98/291 - (33%)
Similarity:151/291 - (51%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ERQHNGSTSGLPRLPGLPTFGTVSAASLIPAQENNVSLTATPS--------RIGQIMKYGFPGLD 85
            |||..||.|....   ...:|...|.:.|    :.::|:..|:        .:..||||||||:|
  Fly    88 ERQDPGSVSIFEH---FLLWGRRKAHNAI----SKMTLSVGPNGSRHENIEHVADIMKYGFPGMD 145

  Fly    86 HVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCD-FKQDESIHPFFRSQNTDYRRS 149
            .:..:.::|||||||||:.|||.||:.:..|.:.|....:|.: :..|.:|...|.:...|::.|
  Fly   146 EIHVYKNFVLSYDRRNRIAHWVCEHVKSGCVQERDEKTLNKPNAYITDNTIPTIFSANMRDFKNS 210

  Fly   150 GYDRGHMAAAGNHRLHQKHCD-----ETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYSNVY 209
            .:..||:|:..|::     ||     |.:..:|:.| :.:|.....|..||::||.....:.:|:
  Fly   211 DWVGGHLASPQNYK-----CDALKFLEAYKFTNIVP-INRGLKNHIWYRLESYVRDKAIEFDSVH 269

  Fly   210 VCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVGE---SADHKLHMESYVMPNQVISN 271
            |.||||::|.:.......|:|.|:|.|||||||||:|:|:.|   :.|..: ||.||:||..:..
  Fly   270 VYTGPLFMPQRITFRNWSVRYHVMGMNTVAVPTHFFKIIIREDEFNRDMPI-MEGYVVPNAYVDK 333

  Fly   272 DTPISVFQVPPESVERSAGLLFFDQINRKQL 302
            |..:..|......:|..|||.|.|...|.||
  Fly   334 DMDLRSFLADVRDIEHFAGLKFCDGQQRDQL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 92/281 (33%)
NUC 77..309 CDD:238043 86/235 (37%)
Tengl4NP_650038.2 Endonuclease_NS 132..362 CDD:279553 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448654
Domainoid 1 1.000 173 1.000 Domainoid score I870
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.