DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and Tengl3

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_608660.3 Gene:Tengl3 / 33404 FlyBaseID:FBgn0051679 Length:337 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:119/279 - (42%) Gaps:70/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PGLPTFGTVSAASL-------------------IPAQENNVSL---TATPSRIGQIMKYGFPGLD 85
            |.|.||||...|.|                   :......|:|   :||.:.:..::|||.|..:
  Fly    56 PMLSTFGTDHEARLWNRPTSWADKFRELVLSPILDLVSATVTLKWDSATTTDLLDLVKYGLPSTE 120

  Fly    86 HVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSG 150
            ::..|.|||:|.|.|.....|:.||                            ||.   ||:|..
  Fly   121 NLYVHKDYVVSQDLRTNGVRWICEH----------------------------FRG---DYQRVS 154

  Fly   151 YDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPL 215
            .|.|     |...::.:: ::.:.||..:..:.:.|.|..||.||.:|..:.|.:.:||..|||:
  Fly   155 SDGG-----GYSTMNLRY-NDVYVLSCGSMSICKAFKRKIWNDLENYVSSMAKEFGSVYAYTGPI 213

  Fly   216 YLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVGESA--DHKLHMESYVMPNQ----VISNDTP 274
            |.|...:.||..:||||.....:.||:||:||::.||.  ..:..||::::.|.    ...||..
  Fly   214 YTPTCYEIGKWTMKYEVFDWIPIPVPSHFFKVLIVESGVPGSQPFMEAFIIENSRRVGGKLNDHR 278

  Fly   275 ISVFQVPPESVERSAGLLF 293
            :.|.:     :||..||.|
  Fly   279 VKVGE-----IERYTGLRF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 76/279 (27%)
NUC 77..309 CDD:238043 64/223 (29%)
Tengl3NP_608660.3 Endonuclease_NS 125..294 CDD:214889 60/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.