DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and Tengl1

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster


Alignment Length:333 Identity:90/333 - (27%)
Similarity:145/333 - (43%) Gaps:67/333 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPRVGGVLALGAT-----ALGAFYLGTHVE------RERQHNGSTSGLPRLPGLPTFGTVSAA 54
            |.|| |.|::.:.||     ||||:|  .|::      |..|.|.....:.|    ..:..:...
  Fly     1 MEAP-VKGIIGILATAGSFFALGAYY--QHIDVMRKIRRLEQRNPHAYFIRR----KLYALLGIF 58

  Fly    55 SLIPAQENNVSLTATPSRIGQIMKYGFPGLDHVRSHS--DYVLSYDRRNRVPHWVFEHLTAESVA 117
            ::.|........|....::|.|||||||..:.:..:.  |:|.|:||||....|:.|.       
  Fly    59 AVRPDNSEFDVDTDDCHKLGGIMKYGFPSTNDITINETFDFVTSFDRRNSAILWMCER------- 116

  Fly   118 KNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSGY-DRGHMAAAGNHRLHQKHCDETFYLSNMAPQ 181
                ||.|                     .|..| |...:|.||  ...|......|:|||:.|.
  Fly   117 ----VDLS---------------------NRVVYGDSTSVAPAG--AFGQSEAARVFFLSNIRPF 154

  Fly   182 VGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYK 246
            :.:|||...|:.|..:|..:::.:..||..||.:|||.:......:::::......|||||||:|
  Fly   155 LNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWFLEFQSEERTMVAVPTHFFK 219

  Fly   247 VIVGE---SADHKLHMESYVMPNQVISNDTPISVFQVPPESVERSAGLLFFDQINRKQLTT---- 304
            ::|.:   :.|...:.|:|||||..::|:..:.........:|.:.||.||:.::|..:.|    
  Fly   220 ILVIDKKFAGDTIPYAEAYVMPNSPLNNNVELKTLLSDVREIENATGLRFFEGLDRNFVNTQASN 284

  Fly   305 -----ING 307
                 :||
  Fly   285 SFVPSVNG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 72/280 (26%)
NUC 77..309 CDD:238043 69/246 (28%)
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 59/210 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.