DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and Exog

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:296 Identity:105/296 - (35%)
Similarity:166/296 - (56%) Gaps:18/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GATALGAFYLGTHVERERQHNGSTSGLPRLP--GLPTFGTVSA-ASLIPAQENNVSLTATPSRIG 74
            |...:..:.||......|:.....:.:|...  |:...|..:| .|.:|..|  ::..:....: 
  Rat    75 GLAEVSEWLLGRGCSGRRRSRADGAAVPPASGRGVREAGEAAARCSTVPGTE--LAFKSVEKVV- 136

  Fly    75 QIMKYGFP--GLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHP 137
             :.::|||  |.: .|.::::.||||:..|||.||.||::.:.:. .|| ||..|.||.|.::..
  Rat   137 -LEQFGFPLTGTE-TRRYTNHALSYDQAKRVPRWVLEHISKDKII-GDA-DRKHCKFKPDPTVPS 197

  Fly   138 FFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRRLT 202
            .|.:.|.||..||:.|||||.|||::...:...|||||||:.||..:. |...||.:|.:.|.||
  Rat   198 AFSALNEDYIGSGWSRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFEN-NSGYWNRIEMYCRELT 261

  Fly   203 KTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVG----ESADHKLHMESYV 263
            :.:.:|::.:|||.|||..:||...|.|:|||.:.||||:|.||||:.    ||.: .|.:.::|
  Rat   262 ERFEDVWIVSGPLTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVILARRSPESTE-PLALGAFV 325

  Fly   264 MPNQVISNDTPISVFQVPPESVERSAGLLFFDQINR 299
            :||:.|...:.:|.|||....:|:.:||:||..::|
  Rat   326 VPNKAIGFQSQLSEFQVSLHDLEKMSGLVFFPHLDR 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 101/270 (37%)
NUC 77..309 CDD:238043 94/229 (41%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 88/212 (42%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102078
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.