DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and ENDOD1

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_055851.1 Gene:ENDOD1 / 23052 HGNCID:29129 Length:500 Species:Homo sapiens


Alignment Length:171 Identity:41/171 - (23%)
Similarity:65/171 - (38%) Gaps:49/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDE----------------SIHPFFRSQ--N 143
            |..|:|:|  |:....|...|...|..|...:.:.|:                |::.....|  |
Human    69 YSTRDRIP--VYSAFRAPRPAPGGAEQRWLVEPQIDDPNSNLEEAINEAEAITSVNSLGSKQALN 131

  Fly   144 TDYRRSGYDRGHM---AAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAW--NTLEAHVRRLTK 203
            |||..|.|.||.:   :.:.:.::      .||.|:|.||.. |.| ::.|  |......|.||.
Human   132 TDYLDSDYQRGQLYPFSLSSDVQV------ATFTLTNSAPMT-QSF-QERWYVNLHSLMDRALTP 188

  Fly   204 ---TYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVP 241
               :..::|:.||.:...::..|             .||||
Human   189 QCGSGEDLYILTGTVPSDYRVKD-------------KVAVP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 41/171 (24%)
NUC 77..309 CDD:238043 41/171 (24%)
ENDOD1NP_055851.1 NUC 65..281 CDD:294067 41/171 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.