DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and ENDOG

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_011516649.1 Gene:ENDOG / 2021 HGNCID:3346 Length:338 Species:Homo sapiens


Alignment Length:219 Identity:106/219 - (48%)
Similarity:135/219 - (61%) Gaps:17/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPRVGGVLALGATALGAFYLGTHVERERQHNGSTSG-LPRLPGLPTFGTVSAASLIPAQENNV 64
            |.|.|.|..||.|| .|||...|.  .|.|:...:..| |.|||.||    |:||:.:|      
Human    90 MRALRAGLTLASGA-GLGAVVEGW--RRRREDARAAPGLLGRLPVLP----VAAAAELP------ 141

  Fly    65 SLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDF 129
            .:...|...|::.|||.|||..::|...|||.||.|.|...||.|.|..|.: :.|. ||.:|||
Human   142 PVPGGPRGPGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERL-RGDG-DRRECDF 204

  Fly   130 KQDESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTL 194
            ::|:|:|.:.|:.|.|||.||:||||:|||.|||..||..|:||||||:||||.. .|::|||.|
Human   205 REDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPH-LNQNAWNNL 268

  Fly   195 EAHVRRLTKTYSNVYVCTGPLYLP 218
            |.:.|.||::|.|||||||||:||
Human   269 EKYSRSLTRSYQNVYVCTGPLFLP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 91/180 (51%)
NUC 77..309 CDD:238043 79/142 (56%)
ENDOGXP_011516649.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146898
Domainoid 1 1.000 249 1.000 Domainoid score I2130
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55823
Inparanoid 1 1.050 263 1.000 Inparanoid score I3092
Isobase 1 0.950 - 0 Normalized mean entropy S973
OMA 1 1.010 - - QHG52002
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 1 1.000 - - otm40477
orthoMCL 1 0.900 - - OOG6_102078
Panther 1 1.100 - - LDO PTHR13966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R945
SonicParanoid 1 1.000 - - X3743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.