DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and LOC105945145

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_017948005.1 Gene:LOC105945145 / 105945145 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:294 Identity:80/294 - (27%)
Similarity:119/294 - (40%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IPAQENNVSLTATPSRIGQIMKYG----FPGL----DHVRSHSDYVLSYDRR------------- 100
            |.|:|    || :|:.|.|  |||    |..|    ..|..:|.|:|  |||             
 Frog    60 IKAKE----LT-SPAYICQ--KYGNRVYFASLYDRGRRVPLYSAYIL--DRRPTSKPINKRQTFF 115

  Fly   101 NRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFRSQ--------NT------DYRRSGY 151
            |..|..::..|....:.:.:..:..| .|....:|.|  |.|        ||      |||.|||
 Frog   116 NIEPQLIYRQLDGTMLPERNTSNNIK-TFNTKHNISP--REQKNQPSSLINTSQAVDADYRNSGY 177

  Fly   152 DRGHMAAAGNHRLHQKHCDE---TFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTG 213
            ||||:    |.|.|....||   ||.|:|:.| :.:..|.:.|:..|..:....|....:||.||
 Frog   178 DRGHV----NPRGHHVTDDEQKGTFTLTNVVP-MAKKLNNEFWSQYENDMIGSAKGCKTMYVVTG 237

  Fly   214 PLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKV--IVGESADHKLHMESYVMPNQVISNDTPIS 276
              .:|.||     ::|     .:.|.:|.:.:..  .||:. |..:...:.:..|.  .:|.|:.
 Frog   238 --IVPSKE-----WIK-----GDRVNIPKYMWNAYCCVGKD-DKPIKSGAGLRKND--DSDKPVE 287

  Fly   277 VFQVPPESVERSAGLLFFDQIN------RKQLTT 304
            ..|: .|..:|...||..:.|:      .|:|.|
 Frog   288 KMQI-NELQKRLKKLLVKENISIFQNNCSKKLQT 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 80/294 (27%)
NUC 77..309 CDD:238043 72/274 (26%)
LOC105945145XP_017948005.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.