DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and LOC103911895

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_009304673.1 Gene:LOC103911895 / 103911895 -ID:- Length:266 Species:Danio rerio


Alignment Length:186 Identity:55/186 - (29%)
Similarity:80/186 - (43%) Gaps:38/186 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDF 129
            :|..|.:||.....|.|.|          .||.|||::   |..|....:..||.:.:  |:.:.
Zfish    62 TLYDTHNRIPVYSAYVFEG----------ALSCDRRDK---WYIEPQLDDIKAKPNMI--SEKEL 111

  Fly   130 KQDESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTL 194
            .:....|   ::.:.||..||:|:||:|.. .|...|...|.||.|:|.||||.: ||:..|..|
Zfish   112 IKGLGDH---QAVSKDYENSGFDKGHLAPV-YHARSQDCADSTFTLTNAAPQVPK-FNKGPWRAL 171

  Fly   195 EAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVI-GANT----VAVPTHFY 245
            |..:     ....::.|....|.|        ||...|: |..|    |.||:||:
Zfish   172 EKFL-----ADKQLHNCLLQKYTP--------YVVTGVVPGRRTLNDRVNVPSHFW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 55/186 (30%)
NUC 77..309 CDD:238043 51/174 (29%)
LOC103911895XP_009304673.1 Endonuclease_NS 58..>220 CDD:214889 55/186 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.