DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and LOC101731854

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_004919666.3 Gene:LOC101731854 / 101731854 -ID:- Length:280 Species:Xenopus tropicalis


Alignment Length:255 Identity:65/255 - (25%)
Similarity:101/255 - (39%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PG------LPTFGTVSAASLIPAQENNVSLTATPS--RIGQIM--KYGFPGLDH----VRSHSDY 93
            ||      |..|..|........|....:..|:||  ||.|.:  :|.:..|.|    |..:|.|
 Frog    15 PGGVICEILQNFSDVPPCQAFFYQGQEPTGLASPSTARICQRLQGQYYYATLYHRDARVPIYSAY 79

  Fly    94 VLSYDRRNR----VPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSGYDRG 154
            :|.....:|    ..:|..|.:.|: :.:.|.:..|:...:.:.......::.|.|||.||:.||
 Frog    80 ILEKSTTSRPDLSSTNWYLEPMLAD-LPQGDMLQPSQSAMQNESEKVTDSQAVNDDYRNSGFSRG 143

  Fly   155 HMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVR-RLTKTYSNVYVCTGPLYLP 218
            |:..:|:|....:  ..||..:|||||.| .||...||..|..:: .:....|..:|.||.:...
 Frog   144 HLNPSGHHSAESQ--ISTFTYTNMAPQQG-NFNSGTWNNYETFLKDSILPGCSQTHVVTGIILSG 205

  Fly   219 HKEDDGKSYVKYEVIGANTVAVPTHFYKVIVGESADHKLHME----SYVMPNQVISNDTP 274
            ....:|       |.....|.|||.::........|.....|    |...|.:|::...|
 Frog   206 SHPGEG-------VWLRGRVNVPTFYWSAFCCVRGDGSRRAEGRLGSNTAPYEVLAKSIP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 65/255 (25%)
NUC 77..309 CDD:238043 53/213 (25%)
LOC101731854XP_004919666.3 Endonuclease_NS 61..261 CDD:214889 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.