DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and exog

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_031760009.1 Gene:exog / 100486077 XenbaseID:XB-GENE-981839 Length:353 Species:Xenopus tropicalis


Alignment Length:296 Identity:111/296 - (37%)
Similarity:160/296 - (54%) Gaps:38/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVLALGATALGAFYLGTHVERERQHNGSTSGLPRLPGLPTFGTVSAASLIPAQENNVSLTATPSR 72
            |...|||.|..|..|......||:.       |:|           |.:.|.|::          
 Frog    11 GGFVLGAAASSASCLAALQLYERRE-------PQL-----------APVAPVQKD---------- 47

  Fly    73 IGQIMKYGFP--GLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESI 135
              .:.:||||  |.: .|.:.::.||||...|.|.||.|||:...:.  .:.||..|.||.|.:|
 Frog    48 --PLEEYGFPLTGYE-ARHYINHALSYDPAKRTPKWVIEHLSGTKIV--GSADRKHCKFKPDPNI 107

  Fly   136 HPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRR 200
            ...|.:.|.||.|||:.|||||.||:::...:...|||||||:.||..:. |...||.:|.:.|.
 Frog   108 PKMFSATNEDYLRSGWTRGHMAPAGDNKFSTEAMAETFYLSNIVPQNYEN-NAGFWNRMEMYCRD 171

  Fly   201 LTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIV--GESADHKLHMESYV 263
            |||.:.:|:|.:|||.||...:|||..|.||||||:.|:||:|.||||:  |:.::..|.:.::|
 Frog   172 LTKRFEDVWVVSGPLELPTLHEDGKKRVMYEVIGADDVSVPSHLYKVILVRGKGSEQPLAVGAFV 236

  Fly   264 MPNQVISNDTPISVFQVPPESVERSAGLLFFDQINR 299
            :||..|..|..:..:||..|.:|:.:||:||.|::|
 Frog   237 VPNSPIGFDRQLPEYQVQLEDLEKMSGLVFFPQLDR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 102/265 (38%)
NUC 77..309 CDD:238043 97/227 (43%)
exogXP_031760009.1 NUC 66..273 CDD:214683 91/210 (43%)
Exog_C 292..336 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.