DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and si:ch211-165i18.2

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001121868.1 Gene:si:ch211-165i18.2 / 100149646 ZFINID:ZDB-GENE-070705-77 Length:595 Species:Danio rerio


Alignment Length:205 Identity:53/205 - (25%)
Similarity:82/205 - (40%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RIGQIMKYG-------FPGLDHVRSHSDYVLSYD---RRNRVPHWVFEHLTAESVAKNDAVDRSK 126
            ||.|.::||       :.....:..:|.|.|..|   ...|...|..|...::..::.|.:.|  
Zfish    47 RICQKVEYGGFYYATLYSVPQRMPLYSAYTLDRDCTTTTGRADVWHVETQISQPGSRTDHMVR-- 109

  Fly   127 CDFKQDESIHPFFRSQ--NTDYRRSGYDRGHMAAAGNHRLHQKHCDE----TFYLSNMAPQVGQG 185
               ::|.:|:.....|  :.||..:||||||:    |....|  |||    ||.|:|.|| :...
Zfish   110 ---ERDSNINTIKAKQAISDDYTDTGYDRGHL----NPNSFQ--CDEGRKATFTLTNAAP-MDAC 164

  Fly   186 FNRDAWNTLEAHVRRL-------TKTYSNVYVCTG-----PLYLPHKEDDGKSYVKYEVIGANTV 238
            |||..|.:.|:..|.|       ..:.:..|:.||     .:.:|.||..         .....|
Zfish   165 FNRIHWKSWESTTRSLLLGKLITDGSSAEAYIVTGTVPSADIRIPQKEVS---------TDPERV 220

  Fly   239 AVPTHFYKVI 248
            .||:|.:..:
Zfish   221 TVPSHIWTAV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 53/205 (26%)
NUC 77..309 CDD:238043 50/200 (25%)
si:ch211-165i18.2NP_001121868.1 Endonuclease_NS 58..278 CDD:214889 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.