DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoG and LOC100002544

DIOPT Version :9

Sequence 1:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster
Sequence 2:XP_001920405.3 Gene:LOC100002544 / 100002544 -ID:- Length:336 Species:Danio rerio


Alignment Length:189 Identity:42/189 - (22%)
Similarity:69/189 - (36%) Gaps:67/189 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 TPSRIGQIMKYGF--PGLDHV-RSHSD---YVLSYDRRNRVP------------------HWVFE 109
            ||.|       ||  |.|..: :.::|   :|..||.:.|:|                  .|::|
Zfish    75 TPPR-------GFKDPSLKKICQRYADKPRFVTLYDPKIRIPVYSAYSFKKTEGDRRVDYPWMYE 132

  Fly   110 HLTAESVAKNDAVDRSKCDFKQDESIHPF--------FRSQNT---DYRRSG-YDRGHMAAAGNH 162
            ...||       :|       .:.::.||        |.....   ||.... |:|||:    |.
Zfish   133 PQLAE-------ID-------GNGNMMPFPTGYLHMKFEDSQAVLDDYSDVVLYERGHL----NP 179

  Fly   163 RLHQKHCDE---TFYLSNMAPQVGQGFNRDAWNTLEAHVRRLTKTY--SNVYVCTGPLY 216
            ..||....:   |:.|:|:.|::.: ||...|...|..:|.....:  ...|:.||.::
Zfish   180 DQHQSDPQDRAATYTLTNVVPEIRE-FNIGPWRQYEERIRVRLNNFCRGTAYIVTGVIH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoGNP_610737.1 NUC1 39..305 CDD:224777 42/189 (22%)
NUC 77..309 CDD:238043 39/181 (22%)
LOC100002544XP_001920405.3 Endonuclease_NS 95..>273 CDD:214889 34/162 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.