DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT5 and VKORC1L1

DIOPT Version :9

Sequence 1:NP_523707.1 Gene:CCT5 / 36308 FlyBaseID:FBgn0010621 Length:542 Species:Drosophila melanogaster
Sequence 2:NP_001271271.1 Gene:VKORC1L1 / 154807 HGNCID:21492 Length:177 Species:Homo sapiens


Alignment Length:98 Identity:18/98 - (18%)
Similarity:31/98 - (31%) Gaps:42/98 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 VPRFEELTPEKLGVAGLVREM-AFGTSKDKMLVIEECKNSKAVTIFLRGGNAMIIAEAKRSIHDA 406
            |||:|.:....:..||::..: |:...::|                           .:...|.|
Human    11 VPRWERVARYAVCAAGILLSIYAYHVEREK---------------------------ERDPEHRA 48

  Fly   407 ICVVRSLVKDSRIVYGGGAAEISCSLAVAKEAD 439
            :|.:...||              ||.|:|...|
Human    49 LCDLGPWVK--------------CSAALASRHD 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT5NP_523707.1 TCP1_epsilon 11..536 CDD:239455 18/98 (18%)
Cpn60_TCP1 45..534 CDD:278544 18/98 (18%)
VKORC1L1NP_001271271.1 VKOR 18..>65 CDD:321633 13/87 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.