DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and oaz2b

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001073559.1 Gene:oaz2b / 790945 ZFINID:ZDB-GENE-070313-1 Length:186 Species:Danio rerio


Alignment Length:184 Identity:45/184 - (24%)
Similarity:72/184 - (39%) Gaps:66/184 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GPLWWSDVPVHHRTDHDRASLLTGYSRKSSVDSAGGS----------LY-EASSRASSLSSSQSD 125
            ||.|.||.|      |.:.|            :||..          || :.......:||..||
Zfish    26 GPQWCSDAP------HTKMS------------TAGQDVNRDLNQDVLLYKDGKLTVKQVSSLDSD 72

  Fly   126 CSDLESQPDIHSLCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWN--TILNPVNNLLYVA 188
            .|.|                     :.|::...|:            :|:  |:|:  .:.|:|.
Zfish    73 SSVL---------------------LFQYELSEQL------------SWSMQTVLS--GHSLFVG 102

  Fly   189 LPKDLPPAGSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFE 242
            ||......|:|:...::||||||||::..:.:...|::||:..|...|.::|||
Zfish   103 LPNGELLKGTKEGLTAVLEFAEEKLKISHVFVWFMKNRPDKLLLTRTFFYLGFE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 22/61 (36%)
oaz2bNP_001073559.1 ODC_AZ 95..178 CDD:280300 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10119
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm25826
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.