DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and Oaz3

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001094488.1 Gene:Oaz3 / 689588 RGDID:1599278 Length:243 Species:Rattus norvegicus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:72/155 - (46%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RASSLSSSQSDCSDLESQPDIHSLCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWNTILN 179
            |:::.....|...:|.|..::..|.:|.         |.|..|||:.....:|.....:|:.:| 
  Rat    96 RSTAQEKDHSQLKELYSAGNLTVLSADP---------LLHQDPVQLDFHFRLTPHSSAHWHGLL- 150

  Fly   180 PVNNLLYVALPKDLPPAGSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFEPL 244
             .::.|::.:|......|::::..:.||:.|||..||.:.:....:..||..|:.||.:||||.:
  Rat   151 -CDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVV 214

  Fly   245 SRKAPQAPPAAINDNENYYFLYSIE 269
            ....|..||.   ||. .:.:|.:|
  Rat   215 RPDHPALPPW---DNV-IFMVYPLE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 25/85 (29%)
Oaz3NP_001094488.1 ODC_AZ 138..234 CDD:280300 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9872
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.