DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and Oaz2

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001103369.1 Gene:Oaz2 / 501454 RGDID:1562933 Length:189 Species:Rattus norvegicus


Alignment Length:182 Identity:50/182 - (27%)
Similarity:82/182 - (45%) Gaps:40/182 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GPLWWSDVPVHHRTDHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLESQPDIH 136
            ||||.||.|      |..:.:..|         .||.                      ..|.:.
  Rat    27 GPLWCSDAP------HPLSKIPGG---------RGGG----------------------RDPSLS 54

  Fly   137 SLCSDDDCQEVLRQILQHD-QPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDLPPAGSKQ 200
            :|...|:...|.:.:...| :|..:..:..|||.:.::|:.:|:  :..|:|.:|..|...|||:
  Rat    55 ALIYKDEKLTVTQDLPVSDGKPHIVHFQYEVTEVKVSSWDAVLS--SQSLFVEIPDGLLADGSKE 117

  Fly   201 TFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFEPLSRKAPQAP 252
            ..::||||||||::|:.:.:...|.:.|||.|::.|.|:|||.:....|..|
  Rat   118 GLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 28/71 (39%)
Oaz2NP_001103369.1 ODC_AZ <100..181 CDD:396602 28/70 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9872
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm44663
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10279
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.