DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and OAZ1

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_004143.1 Gene:OAZ1 / 4946 HGNCID:8095 Length:228 Species:Homo sapiens


Alignment Length:256 Identity:73/256 - (28%)
Similarity:106/256 - (41%) Gaps:66/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IQNENQKILCDPVFSSGFVRREFNDSGIADGKLRTISTSSCATTM--------SSESYRISL--- 69
            :::..|:||    .|..|.|.:..|...|     ||..|.....:        ||||.|:||   
Human     2 VKSSLQRIL----NSHCFAREKEGDKPSA-----TIHASRTMPLLSLHSRGGSSSESSRVSLHCC 57

  Fly    70 ---GVGPLWWSDVPVHHRTDHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLES 131
               |.||.|.||.|      |....:..|...              |.|..:||:          
Human    58 SNPGPGPRWCSDAP------HPPLKIPGGRGN--------------SQRDHNLSA---------- 92

  Fly   132 QPDIHSLCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDLPPA 196
                 :|...||...|..::..:|:...:.::..:|:.:..||.|:|:  ...||:.:|....|.
Human    93 -----NLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLS--GGSLYIEIPGGALPE 150

  Fly   197 GSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFE------PLSRKAPQA 251
            |||.:|..|||||||:|..|.:.:...|::.|||.|:..|.|:|||      ||..|.|.|
Human   151 GSKDSFAVLLEFAEEQLRADHVFICFHKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 32/76 (42%)
OAZ1NP_004143.1 ODC_AZ <138..217 CDD:280300 32/74 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10668
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5256
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm40521
orthoMCL 1 0.900 - - OOG6_106720
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4699
SonicParanoid 1 1.000 - - X5172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.