DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and oaz1b

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_919413.2 Gene:oaz1b / 259193 ZFINID:ZDB-GENE-020731-5 Length:218 Species:Danio rerio


Alignment Length:236 Identity:60/236 - (25%)
Similarity:97/236 - (41%) Gaps:58/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IQNENQKILCDPVFSSGFVRREFNDSGIADGKLRTISTSSCATTMSSESYRISLGVGPLWWSDVP 80
            :::..|:||....|:.....::..:|.|.:....:|:....:.|:...|   :.|.||||.||.|
Zfish     2 VKSNLQRILNSHCFAREKEGKKQCESSIMEALSSSITDRMASLTVCCSS---TTGPGPLWCSDAP 63

  Fly    81 VHHRTDHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLESQPDIHSLCSDDDCQ 145
                  |....:            .||....|....|:..:..||                    
Zfish    64 ------HPPLKI------------PGGRGNGARDHPSTTQTLYSD-------------------- 90

  Fly   146 EVLRQILQHDQPV-----QITIKLHV----TEDQYTNWNTILNPVNNLLYVALPKDLPPAGSKQT 201
               |::...::|.     ||   ||.    ...:...|..:|.  .:.|:|.:|.:..|.|||::
Zfish    91 ---RKLTVTEEPAGPGRPQI---LHFQSRPAAARLIQWEAVLR--GDGLFVEIPCEPFPDGSKES 147

  Fly   202 FISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFE 242
            ||||||||||.|:|..:.:...|::.||.:|:..|.|:|||
Zfish   148 FISLLEFAEEHLKVVSVFVCFYKNREDRVKLVRTFSFLGFE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 28/61 (46%)
oaz1bNP_919413.2 ODC_AZ 128..209 CDD:280300 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10119
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm25826
orthoMCL 1 0.900 - - OOG6_106720
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.