DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and oaz1a

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_919240.2 Gene:oaz1a / 259192 ZFINID:ZDB-GENE-020731-4 Length:214 Species:Danio rerio


Alignment Length:230 Identity:65/230 - (28%)
Similarity:88/230 - (38%) Gaps:81/230 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SSESYRISLGV-GPLWWSDVPV----------HHRTDHDRASLLTGYSRKSSVDSAGGSLYEASS 114
            |..|:|.|... ||||.||||:          :.:.||                          |
Zfish    38 SESSHRCSNPCPGPLWCSDVPLPPLKIPGGRGNDQRDH--------------------------S 76

  Fly   115 RASSLSSSQSDCSDLESQPDIHS----LCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWN 175
            .::.|..|.:....||..|..:|    |..:..|                ::..|:.      |.
Zfish    77 LSAKLFYSDAQLLVLEEAPQSNSRVRFLLFERRC----------------SVSKHLV------WR 119

  Fly   176 TILNPVNNLLYVALPKDLPPAGSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMG 240
            ..|...|  ||:.:|..:.|.|||.:|..|||||||||:||.:.:...|.:.|||.|:..|.|||
Zfish   120 GALKGTN--LYIEIPTGVLPEGSKDSFSLLLEFAEEKLQVDHVFICFHKSRDDRASLLRTFSFMG 182

  Fly   241 FE------PLSRKAPQAPPAAINDNENYYFLYSIE 269
            ||      ||   .|..|.|       ::..|.||
Zfish   183 FEIVRPGHPL---VPTRPDA-------FFMAYRIE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 37/91 (41%)
oaz1aNP_919240.2 ODC_AZ 115..206 CDD:280300 40/108 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10119
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm25826
orthoMCL 1 0.900 - - OOG6_106720
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4699
SonicParanoid 1 1.000 - - X5172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.