DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and spa1

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_595312.1 Gene:spa1 / 2540881 PomBaseID:SPBC577.14c Length:226 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:20/105 - (19%)
Similarity:46/105 - (43%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DCQEVLRQILQHDQPVQITIKLHVTEDQYTNWNTILNPV---NNLLYVALPKDLPPAGSKQTFIS 204
            ||.|                ::.|.|.. ..|:.|:...   :..|:: :|:.......|:..::
pombe   125 DCDE----------------RIGVAESM-NYWHGIVRTEEDGSKTLFL-IPESWEDVHLKEGLVA 171

  Fly   205 LLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFEPL 244
            :::.|.::|....:|:.:.|:......|:::..::|||||
pombe   172 IIDLAVDRLHCSKLVLFVDKNNSSLPYLVKSLHWVGFEPL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 13/63 (21%)
spa1NP_595312.1 ODC_AZ 139..226 CDD:280300 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106720
Panther 1 1.100 - - LDO PTHR10279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.