DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oda and Oaz1

DIOPT Version :9

Sequence 1:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_032779.2 Gene:Oaz1 / 18245 MGIID:109433 Length:227 Species:Mus musculus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:116/277 - (41%) Gaps:82/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IQNENQKILCDPVFSSGFVRREFNDSGIADGKLRTISTSSCATTM-----------SSESYRI-- 67
            :::..|:||....|:     ||      .:|..|: :|...:.||           ||||.|:  
Mouse     2 VKSSLQRILNSHCFA-----RE------KEGDKRS-ATLHASRTMPLLSQHSRGGCSSESSRVAL 54

  Fly    68 ----SLGVGPLWWSDVPVHHRTDHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSD 128
                :||.||.|.||||      |....:..|...              |.|..|||:       
Mouse    55 NCCSNLGPGPRWCSDVP------HPPLKIPGGRGN--------------SQRDHSLSA------- 92

  Fly   129 LESQPDIHSLCSDDDCQEVLRQILQHDQPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDL 193
                    |:...|:...|..:...:|:...::|:..:||.:...|..:.:  ...||:.||...
Mouse    93 --------SILYSDERLNVTEEPTSNDKTRVLSIQSTLTEAKQVTWRAVWS--GGGLYIELPAGP 147

  Fly   194 PPAGSKQTFISLLEFAEEKLEVDGIVMVMPKDQPDRARLIEAFLFMGFE------PLSRKAPQAP 252
            .|.|||.:|.:|||||||:|:.|.:.:..||::.|||.|:..|.|:|||      ||..|.|.| 
Mouse   148 LPEGSKDSFAALLEFAEEQLQADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDA- 211

  Fly   253 PAAINDNENYYFLYSIE 269
                     .:.:|::|
Mouse   212 ---------CFMVYTLE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 35/91 (38%)
Oaz1NP_032779.2 ODC_AZ 128..218 CDD:307973 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9991
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5233
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 1 1.000 - - FOG0002095
OrthoInspector 1 1.000 - - otm42594
orthoMCL 1 0.900 - - OOG6_106720
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4699
SonicParanoid 1 1.000 - - X5172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.