DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and LSM6

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_010666.2 Gene:LSM6 / 851984 SGDID:S000002786 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:15/71 - (21%)
Similarity:33/71 - (46%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANL----ENVYIRG 65
            |..:.|.:..|..:..:..:|.:|.|:|...:..||..::..|..|.......|    .:|::||
Yeast    11 VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRG 75

  Fly    66 SKIRFL 71
            :::.::
Yeast    76 TQVMYI 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 14/70 (20%)
LSM6NP_010666.2 Sm_like 14..82 CDD:412267 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.