DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and SMD3

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_013248.1 Gene:SMD3 / 850839 SGDID:S000004137 Length:101 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:40/86 - (46%)
Similarity:67/86 - (77%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKI 68
            |:|:|:|:||:|||::.|..||..|||||:|:||:||.|:..:..|...|...:::.:::|||:|
Yeast     5 GIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQI 69

  Fly    69 RFLILPDMLKNAPMFKKQTGK 89
            :|:::||:|||||:|||.:.:
Yeast    70 KFIVVPDLLKNAPLFKKNSSR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 29/68 (43%)
SMD3NP_013248.1 Sm_D3 7..76 CDD:212468 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341684
Domainoid 1 1.000 70 1.000 Domainoid score I2276
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I1429
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53728
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - oto99103
orthoMCL 1 0.900 - - OOG6_102085
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1359
SonicParanoid 1 1.000 - - X3092
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.