DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and SmD3

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_177757.1 Gene:SmD3 / 843963 AraportID:AT1G76300 Length:128 Species:Arabidopsis thaliana


Alignment Length:126 Identity:68/126 - (53%)
Similarity:91/126 - (72%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGS 66
            |:|:|:|:|||:.|||::.|..:||:|||.:||.|||.|||:..||.|.:||:.:.||:|:||||
plant     4 SLGIPVKLLHESSGHIVSVEMKSGELYRGSMIECEDNWNCQLENITYTAKDGKVSQLEHVFIRGS 68

  Fly    67 KIRFLILPDMLKNAPMFKKQTGKGLGGT--AGRGKAAILRAQARGRGRGGPPGGGRGTGGP 125
            .:|||::|||||||||||...|||...:  .|||:.|.:||:..|||    .|||||...|
plant    69 LVRFLVIPDMLKNAPMFKDVRGKGKSASLGVGRGRGAAMRAKGTGRG----TGGGRGAVPP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 37/68 (54%)
SmD3NP_177757.1 Sm_D3 8..77 CDD:212468 37/68 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2749
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3078
Inparanoid 1 1.050 143 1.000 Inparanoid score I1770
OMA 1 1.010 - - QHG53728
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - otm3193
orthoMCL 1 0.900 - - OOG6_102085
Panther 1 1.100 - - O PTHR23338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.